Flt-3 ligand (FL) is a recently identified hematopoietic cytokine whose activities are mediated by binding to the transmembrane glycoprotein Flt-3. Flt-3 was first discovered as a member of the class III subfamily of receptor tyrosine kinases (RTK) whose expression among hematopoietic cells was found to be restricted to highly enriched stem/progenitor cell populations. Additionally, class III RTKs include the receptors from SCF, M-CSF and PDGF. Not surprisingly, Flt-3 ligand is also structurally related to M-CSF and SCF. All three cytokines have been shown to exist both as type I transmembrane proteins and as soluble proteins. The predominant human FL isoform is a transmembrane protein that can undergo proteolytic cleavage to generate a soluble form of the protein. FL has been shown to synergize with a wide variety of hematopoietic cytokines to stimulate the growth and differentiation of early hematopoietic progenitors.

 

Product Properties

Synonyms	Receptor-type tyrosine-protein kinase FLT3, FL cytokine receptor
Accession	H9Z6V7
GeneID	719239
Source	E.coli-derived Rhesus Macaque Fms-related Tyrosine Kinase 3 Ligand protein, Thr27-Pro185
Molecular Weight	Approximately 18.0 kDa.
AA Sequence	TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLP PPRSPGALEA TALTAPQRP
Tag	None
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Purity	> 97 % by SDS-PAGE and HPLC analyses.
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human AML5 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 106 IU/mg.
Endotoxin	< 1.0 EU per 1μg of the protein by the LAL method.
Formulation	Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.

 

Shipping and Storage

The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.

Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

 

Cautions

1. Avoid repeated freeze-thaw cycles.

2. For your safety and health, please wear lab coats and disposable gloves for operation.

3. For research use only!

 

HB220419